IFIT5 Antibody - N-terminal region : FITC

IFIT5 Antibody - N-terminal region : FITC
SKU
AVIARP54897_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT5

Key Reference: Niikura,T., (1997) Blood Cells Mol. Dis. 23 (3), 337-349

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced protein with tetratricopeptide repeats 5

Protein Size: 482

Purification: Affinity Purified
More Information
SKU AVIARP54897_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54897_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24138
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×