IFNA5 Antibody - middle region : FITC

IFNA5 Antibody - middle region : FITC
SKU
AVIARP54652_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFNA5

Key Reference: Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-5

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP54652_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54652_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3442
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×