IFNA7 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFNA7

Key Reference: Nyman,T.A., Biochem. J. 329 (PT 2), 295-302 (1998)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon alpha-7

Protein Size: 189

Purification: Affinity Purified

• SKU: AVIARP55373_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55373_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3444
• Host: Rabbit