IFNA8 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: IFNA8 is produced by macrophages, IFN-alpha have antiviral activities. It is a interferon which stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA8

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-8

Protein Size: 189

Purification: Affinity Purified

• SKU: AVIARP54654_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54654_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3445
• Host: Rabbit