IFRD1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFRD1

Key Reference: Batta,K. (2007) Mol. Cell. Biol. 27 (21), 7603-7614

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-related developmental regulator 1

Protein Size: 451

Purification: Affinity Purified

• SKU: AVIARP54584_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54584_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3475
• Host: Rabbit