IFRD1 Antibody - N-terminal region : HRP

IFRD1 Antibody - N-terminal region : HRP
SKU
AVIARP54584_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFRD1

Key Reference: Batta,K. (2007) Mol. Cell. Biol. 27 (21), 7603-7614

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon-related developmental regulator 1

Protein Size: 451

Purification: Affinity Purified
More Information
SKU AVIARP54584_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54584_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3475
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×