IL1F5 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL1F5

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interleukin-36 receptor antagonist protein

Protein Size: 155

Purification: Affinity Purified

• SKU: AVIARP55628_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55628_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26525
• Host: Rabbit