IL8/CXCL8 Antibody (HRP)

Uniprot: P10145

Gene Name: CXCL8

Immunogen: Recombinant human CXCL8

Purity: ≥85%

Formulation: Liquid in PBS containing 0.01% thimerosal

Identity-Mouse (%): 53%

Core Sequence: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%

Alternative gene names: IL8

Alternative protein names: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8)77; GCP/IL-8 protein II; IL-8(1-77); IL8/NAP1 form II; MDNCF-b; IL-8(5-77; IL-8(6-77; (Ser-IL-8)72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8(7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8(8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8(9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]

Protein name: C-X-C motif chemokine ligand 8

Product panel: Cytokines

Clone No.: KT215

Antigen Species: Human

Target Name: CXCL8

IHC Verification: -

IHC Dilution: N/A

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-530

Cross reactivity: Not tested

• SKU: ASBKH-404-50
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KH-404-50
• Package Unit: 50 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG1
• Human Gene ID: 3576
• Host: Mouse
• Conjugate: Conjugated, HRP