ILDR1 Antibody - middle region : HRP

ILDR1 Antibody - middle region : HRP
SKU
AVIARP55751_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ILDR1 is a putative membrane receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Key Reference: Hauge,H., (2004) Biochem. Biophys. Res. Commun. 323 (3), 970-978

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immunoglobulin-like domain-containing receptor 1

Protein Size: 502

Purification: Affinity Purified
More Information
SKU AVIARP55751_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55751_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286676
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×