INKA2 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf183

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: GDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PAK4-inhibitor INKA2

Protein Size: 382

Purification: Affinity Purified

• SKU: AVIARP57804_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57804_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55924
• Host: Rabbit