INPP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: inositol polyphosphate 1-phosphatase

Protein Size: 399

Purification: Affinity Purified

• SKU: AVIARP54666_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54666_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3628
• Host: Rabbit