INPP5F Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP5F

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositide phosphatase SAC2

Protein Size: 375

Purification: Affinity Purified

• SKU: AVIARP55113_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55113_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22876
• Host: Rabbit