INPP5F Antibody - N-terminal region : FITC

INPP5F Antibody - N-terminal region : FITC
SKU
AVIARP55113_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP5F

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositide phosphatase SAC2

Protein Size: 375

Purification: Affinity Purified
More Information
SKU AVIARP55113_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55113_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22876
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×