INTS13 Antibody - middle region : Biotin

INTS13 Antibody - middle region : Biotin
SKU
AVIARP57133_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C12orf11

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: integrator complex subunit 13

Protein Size: 706

Purification: Affinity Purified
More Information
SKU AVIARP57133_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57133_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55726
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×