IPP Antibody - C-terminal region : FITC

IPP Antibody - C-terminal region : FITC
SKU
AVIARP54790_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin. Transcript variants have been described but their full-length nature has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IPP

Key Reference: VanHouten,J.N., (2001) Oncogene 20 (38), 5366-5372

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-binding protein IPP

Protein Size: 584

Purification: Affinity Purified
More Information
SKU AVIARP54790_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54790_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3652
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×