ISG20 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ISG20

Molecular Weight: 19 kDa

Peptide Sequence: Synthetic peptide located within the following region: STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: interferon-stimulated gene 20 kDa protein

Protein Size: 181

Purification: Affinity purified

• SKU: AVIARP59089_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59089_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3669
• Host: Rabbit
• Conjugate: Conjugated, Biotin