IVD Antibody - N-terminal region : FITC

IVD Antibody - N-terminal region : FITC
SKU
AVIARP58485_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IVD

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isovaleryl-CoA dehydrogenase, mitochondrial

Protein Size: 423

Purification: Affinity Purified
More Information
SKU AVIARP58485_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58485_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3712
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×