IZUMO1R Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOLR4

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: sperm-egg fusion protein Juno

Protein Size: 243

Purification: Affinity Purified

• SKU: AVIARP59117_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59117_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 390243
• Host: Rabbit