JMJD5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD5

Key Reference: Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-specific demethylase 8

Protein Size: 416

Purification: Affinity Purified

• SKU: AVIARP58120_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58120_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 79831
• Host: Rabbit