JMJD5 Antibody - middle region : HRP

JMJD5 Antibody - middle region : HRP
SKU
AVIARP58120_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD5

Key Reference: Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lysine-specific demethylase 8

Protein Size: 416

Purification: Affinity Purified
More Information
SKU AVIARP58120_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58120_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 79831
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×