KCTD21 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD21

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BTB/POZ domain-containing protein KCTD21

Protein Size: 260

Purification: Affinity Purified

• SKU: AVIARP54466_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54466_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 283219
• Host: Rabbit