KDM7A Antibody - C region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JHDM1D

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: lysine-specific demethylase 7A

Protein Size: 941

Purification: Affinity Purified

• SKU: AVIARP58206_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58206_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 80853
• Host: Rabbit