KIAA0776 Antibody - middle region : Biotin

KIAA0776 Antibody - middle region : Biotin
SKU
AVIARP55228_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0776

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 UFM1-protein ligase 1

Protein Size: 794

Purification: Affinity Purified
More Information
SKU AVIARP55228_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55228_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23376
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×