KIAA0776 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0776

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 UFM1-protein ligase 1

Protein Size: 794

Purification: Affinity Purified

• SKU: AVIARP55228_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55228_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23376
• Host: Rabbit