KIAA0776 Antibody - middle region : HRP

KIAA0776 Antibody - middle region : HRP
SKU
AVIARP55228_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0776

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 UFM1-protein ligase 1

Protein Size: 794

Purification: Affinity Purified
More Information
SKU AVIARP55228_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55228_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23376
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×