KIAA0892 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Key Reference: Seitan,V.C., PLoS Biol. 4 (8), E242 (2006)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAU2 chromatid cohesion factor homolog

Protein Size: 613

Purification: Affinity Purified

Subunit: SCC4 homolog

• SKU: AVIARP55232_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55232_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23383
• Host: Rabbit