KIAA0930 Antibody - C-terminal region : Biotin

KIAA0930 Antibody - C-terminal region : Biotin
SKU
AVIARP55214_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Key Reference: N/A

Molecular Weight: 40 kDa

Peptide Sequence: Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 370

Purification: Affinity purified
More Information
SKU AVIARP55214_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55214_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23313
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×