KIAA0930 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Key Reference: N/A

Molecular Weight: 40 kDa

Peptide Sequence: Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 370

Purification: Affinity purified

• SKU: AVIARP55214_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55214_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23313
• Host: Rabbit