KIAA1189 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1189

Key Reference: Brockschnieder,D., (2006) J. Neurosci. 26 (3), 757-762

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ermin

Protein Size: 297

Purification: Affinity Purified

• SKU: AVIARP56188_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56188_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57471
• Host: Rabbit