KIAA1191 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191

Key Reference: Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative monooxygenase p33MONOX

Protein Size: 305

Purification: Affinity Purified

• SKU: AVIARP56290_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56290_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57179
• Host: Rabbit