KIF17 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse KIF17

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: TGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: kinesin-like protein KIF17

Protein Size: 511

Purification: Affinity Purified

• SKU: AVIARP57461_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57461_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57576
• Host: Rabbit