KIFAP3 Antibody - middle region : Biotin

KIFAP3 Antibody - middle region : Biotin
SKU
AVIARP55127_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kinesin-associated protein 3

Protein Size: 792

Purification: Affinity Purified
More Information
SKU AVIARP55127_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55127_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22920
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×