KLHDC4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC4

Key Reference: Segade,F., (2007) Int. J. Biochem. Cell Biol. 39 (12), 2303-2313

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch domain-containing protein 4

Protein Size: 520

Purification: Affinity Purified

• SKU: AVIARP56977_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56977_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54758
• Host: Rabbit