KLHL7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL7

Key Reference: Bredholt,G., (2006) Scand. J. Immunol. 64 (3), 325-335

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 7

Protein Size: 564

Purification: Affinity Purified

• SKU: AVIARP56234_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56234_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55975
• Host: Rabbit