KLHL9 Antibody - middle region : Biotin

KLHL9 Antibody - middle region : Biotin
SKU
AVIARP57295_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of c

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL9

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 9

Protein Size: 617

Purification: Affinity Purified
More Information
SKU AVIARP57295_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57295_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55958
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×