KLK13 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLK13

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kallikrein-13

Protein Size: 277

Purification: Affinity Purified

• SKU: AVIARP55295_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55295_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26085
• Host: Rabbit