KLK13 Antibody - N-terminal region : HRP

KLK13 Antibody - N-terminal region : HRP
SKU
AVIARP55294_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLK13

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: GKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kallikrein-13

Protein Size: 277

Purification: Affinity Purified
More Information
SKU AVIARP55294_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55294_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26085
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×