KLK7 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KLK7

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kallikrein-7

Protein Size: 181

Purification: Affinity Purified

• SKU: AVIARP57735_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57735_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5650
• Host: Rabbit