KRAS Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase NRas

Protein Size: 189

Purification: Affinity Purified

Specificity#: 100% homologous to human KRAS, NRAS and HRAS.

• SKU: AVIARP55408_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55408_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3845
• Host: Rabbit