KRT75 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRT75

Key Reference: Schweizer,J., (2006) J. Cell Biol. 174 (2), 169-174

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Keratin, type II cytoskeletal 75

Protein Size: 551

Purification: Affinity Purified

• SKU: AVIARP58768_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58768_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9119
• Host: Rabbit
• Conjugate: Conjugated, HRP