KRT87P Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT83

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 447

Purification: Affinity Purified

• SKU: AVIARP55405_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55405_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Host: Rabbit