LAMP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 355

Purification: Affinity Purified

• SKU: AVIARP58911_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58911_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3916
• Host: Rabbit