LANCL2 Antibody - middle region : Biotin

LANCL2 Antibody - middle region : Biotin
SKU
AVIARP57286_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LANCL2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 2

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP57286_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57286_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55915
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×