LANCL2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LANCL2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 2

Protein Size: 450

Purification: Affinity Purified

• SKU: AVIARP57285_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57285_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55915
• Host: Rabbit