LANCL3 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of LANCL3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LANCL3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 3

Protein Size: 388

Purification: Affinity Purified

• SKU: AVIARP55888_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55888_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 347404
• Host: Rabbit