LANCL3 Antibody - C-terminal region : HRP

LANCL3 Antibody - C-terminal region : HRP
SKU
AVIARP55888_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of LANCL3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LANCL3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LanC-like protein 3

Protein Size: 388

Purification: Affinity Purified
More Information
SKU AVIARP55888_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55888_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 347404
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×