LAP3 Antibody - N-terminal region : FITC

LAP3 Antibody - N-terminal region : FITC
SKU
AVIARP56769_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAP3

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosol aminopeptidase

Protein Size: 519

Purification: Affinity Purified
More Information
SKU AVIARP56769_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56769_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51056
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×