LASP1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.This gene encodes a member of a LIM protein subfamily which is characterized by a LIM motif and a domain of Src homology region 3. This protein functions as an actin-binding protein and possibly in cytoskeletal organization. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LASP1

Key Reference: Stone,J.L., (2007) Hum. Mol. Genet. 16 (6), 704-715

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LIM and SH3 domain protein 1

Protein Size: 261

Purification: Affinity Purified

• SKU: AVIARP54797_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54797_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3927
• Host: Rabbit