LCN12 Antibody - N-terminal region : Biotin

LCN12 Antibody - N-terminal region : Biotin
SKU
AVIARP58489_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LCN12 protein EMBL AAH41168.1

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP58489_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58489_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286256
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×