LCN12 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LCN12 protein EMBL AAH41168.1

Protein Size: 355

Purification: Affinity Purified

• SKU: AVIARP58489_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58489_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 286256
• Host: Rabbit
• Conjugate: Conjugated, FITC